Ubiquitin-Protein Ligase E3 Mdm2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ubiquitin-Protein Ligase E3 Mdm2
  Conformer 1
(PDB) 		1ycr (A)
  Conformer 2
(PDB) 		1t4e (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 51 0.66   56 - 106
2 30 0.42   27 - 55   107 - 107

Sequence


           ______________________________________55________________________________________________106_____                         
 1ycr(A) : *********ETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVV**                         
         :                                                                                                                          
 1t4e(A) : GSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN                         
           ______________________________________55________________________________________________106_____                         

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.3
Translation
(A) 		0.2
Closure
(%) 		53.2
Bending Residues
( green ) 		  55 - 56
  106 - 107
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download