Proactivator Polypeptide

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Proactivator Polypeptide
  Conformer 1
(PDB) 		2dob (A)
  Conformer 2
(PDB) 		4ddj (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 39 1.39   24 - 63
2 34 2.23   3 - 23   64 - 78

Sequence


           _____________________22_____________________________________61____________________                                       
 2dob(A) : GSLPCDICKDVVTAAGD-lKDNATEEEILVYLEKTCDWLPKPN-sASCKEIVDSYLPVILDIIKGE-sRPGEVCSALNLCES                                       
         :                                                                                                                          
 4ddj(A) : *SLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCE*                                       
           _____________________22_____________________________________61____________________                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		137.0
Translation
(A) 		0.4
Closure
(%) 		47.1
Bending Residues
( green ) 		  22 - 25
  61 - 64
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download