Shikimate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Shikimate Kinase
  Conformer 1
(PDB) 		2iyr (B)
  Conformer 2
(PDB) 		2iyy (A)
  Window Length 15
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 116 0.74   9 - 96   124 - 147   157 - 160
2 28 1.05   97 - 112   148 - 156   161 - 163

Sequence


           _____________________________________________________________________________________________96_____________112_________ 
 2iyr(B) : APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTV--lLA 
         :                                                                                                                          
 2iyy(A) : APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLA 
           _____________________________________________________________________________________________96_____________112_________ 

           ________________140_____________156_160__________                                                                        
 2iyr(B) : GPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPS                                                                        
         :                                                                                                                          
 2iyy(A) : GPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPS                                                                        
           ________________140_____________156_160__________                                                                        

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		12.0
Translation
(A) 		-0.3
Closure
(%) 		58.3
Bending Residues
( green ) 		  96 - 97
  112 - 131
  140 - 148
  156 - 157
  160 - 161
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download