Small Ubiquitin-Related Modifier 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Small Ubiquitin-Related Modifier 1
  Conformer 1
(PDB) 		3kyc (D)
  Conformer 2
(PDB) 		3kyd (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 52 0.61   23 - 45   64 - 72   75 - 94
2 20 0.66   46 - 63   73 - 74

Sequence


           _________________________45________________63_______72_________________________                                          
 3kyc(D) : GEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQCGG                                          
         :                                                                                                                          
 3kyd(D) : *EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQCG*                                          
           _________________________45________________63_______72_________________________                                          

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.0
Translation
(A) 		-0.1
Closure
(%) 		73.3
Bending Residues
( green ) 		  45 - 46
  63 - 64
  72 - 75
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download