Transcription Antitermination Protein Nusg

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Transcription Antitermination Protein Nusg
  Conformer 1
(PDB) 		1npp (B)
  Conformer 2
(PDB) 		1npr (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 86 1.48   51 - 130   185 - 190
2 94 0.95   10 - 50   132 - 184
3 56 1.88   191 - 246

Sequence


           __________________________________________50____________________________________________________________________________ 
 1npp(B) : *ELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEA 
         :                                                                                                                          
 1npr(A) : QELEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEA 
           __________________________________________50____________________________________________________________________________ 

           _130___________________________________________________184______________________________________________________________ 
 1npp(B) : KIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVE 
         :                                                                                                                          
 1npr(A) : KIVLDNKIFPGYILIKAHMNDKLLMAIEKTPHVFRPVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGTVEEVHPEKRKLTVMISIFGRMTPVELDFDQVE 
           _130___________________________________________________184______________________________________________________________ 

           __                                                                                                                       
 1npp(B) : KI                                                                                                                       
         :                                                                                                                          
 1npr(A) : KI                                                                                                                       
           __                                                                                                                       

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		27.0
Translation
(A) 		0.5
Closure
(%) 		50.1
Bending Residues
( green ) 		  50 - 51
  130 - 137
  184 - 190
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		65.4
Translation
(A) 		-8.2
Closure
(%) 		24.1
Bending Residues
( green ) 		  185 - 195
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download