Troponin C

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Troponin C
  Conformer 1
(PDB) 		2tn4  
  Conformer 2
(PDB) 		4tnc  
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 94 1.54   3 - 35   72 - 99   104 - 111   129 - 153
2 28 1.34   36 - 63
3 21 1.19   100 - 103   112 - 128

Sequence


           _________________________________34___________________________63__________________________________99_103_____111________ 
 2tn4    : *TDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAELFRIFDRNADGYIDAEELAEIF 
         :                                                                                                                          
 4tnc    : AMDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELADCFRIFDKNADGFIDIEELGEIL 
           _________________________________37___________________________66_________________________________102_106_____114________ 

           ______128_______________________________                                                                                 
 2tn4    : RASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMM****                                                                                 
         :                                                                                                                          
 4tnc    : RATGEHVTEEDIEDLMKDSDKNNDGRIDFDEFLKMMEGVQ                                                                                 
           ______131_______________________________                                                                                 

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		50.8
Translation
(A) 		1.1
Closure
(%) 		96.2
Bending Residues
( green ) 		  34 - 38
  63 - 72
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		10.2
Translation
(A) 		-0.6
Closure
(%) 		87.9
Bending Residues
( green ) 		  99 - 100
  103 - 104
  111 - 112
  128 - 129
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download