Glutamate Receptor Subunit 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor Subunit 2
  Conformer 1
(PDB) 		1fto (A)
  Conformer 2
(PDB) 		1m5e (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 28 0.4   109 - 110   194 - 218   259 - 259
2 142 0.47   7 - 108   219 - 258
3 83 0.42   111 - 193

Sequence


           ______________________________________________________________________________________________________108_______________ 
 1fto(A) : *TVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
         :                                                                                                                          
 1m5e(A) : KTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
           ______________________________________________________________________________________________________108_______________ 

           ___________________________________________________________________193_____________________217__________________________ 
 1fto(A) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
         :                                                                                                                          
 1m5e(A) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
           ___________________________________________________________________193_____________________217__________________________ 

           ____________258___                                                                                                       
 1fto(A) : QGLLDKLKNKWWYDKGEC                                                                                                       
         :                                                                                                                          
 1m5e(A) : QGLLDKLKNKWWYDKGEC                                                                                                       
           ____________258___                                                                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		14.7
Translation
(A) 		0.3
Closure
(%) 		97.2
Bending Residues
( green ) 		  108 - 109
  217 - 219
  258 - 259
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		7.8
Translation
(A) 		-0.1
Closure
(%) 		95.0
Bending Residues
( green ) 		  110 - 111
  193 - 194
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download