Glutamate Receptor, Ionotropic Kainate 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 2
  Conformer 1
(PDB) 		1yae (C)
  Conformer 2
(PDB) 		1s50 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 138 0.77   431 - 532   764 - 794   796 - 800
2 109 1.01   533 - 763   795 - 795

Sequence


           ___________________________________________________________________________________________________________532__________ 
 1yae(C) : NITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILY 
         :                                                                                                                          
 1s50(A) : ******SNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILY 
           ___________________________________________________________________________________________________________105__________ 

           __________________________________________________________________________________________________763___________________ 
 1yae(C) : RK--P-dSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAI 
         :                                                                                                                          
 1s50(A) : RKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAI 
           __________________________________________________________________________________________________216___________________ 

           _________794____________                                                                                                 
 1yae(C) : LQLQEEGKLHMMKEKWWRGN****                                                                                                 
         :                                                                                                                          
 1s50(A) : LQLQEEGKLHMMKEKWWRGNGCPE                                                                                                 
           _________247____________                                                                                                 

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		13.1
Translation
(A) 		-0.3
Closure
(%) 		86.9
Bending Residues
( green ) 		  532 - 533
  763 - 764
  794 - 796
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download