Glutamate Receptor, Ionotropic Kainate 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 1
  Conformer 1
(PDB)
4e0x (A)
  Conformer 2
(PDB)
2pbw (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 149 0.38   11 - 17   19 - 19   34 - 35   57 - 62   88 - 88   101 - 104   108 - 214   226 - 229   233 - 249
2 95 0.28   6 - 10   18 - 18   20 - 33   36 - 56   63 - 87   89 - 100   105 - 107   215 - 225   230 - 232

Sequence


           _____10_____17______________33_____________________56____62_______________________87__________100_104___________________ 
 4e0x(A) : RTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPIDSA 
         :                                                                                                                          
 2pbw(A) : RTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPIDSA 
           _____10_____17______________33_____________________56____62_______________________87__________100_104___________________ 

           ______________________________________________________________________________________212__________225_229______________ 
 4e0x(A) : DDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKL 
         :                                                                                                                          
 2pbw(A) : DDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKL 
           ______________________________________________________________________________________212__________225_229______________ 

           _________                                                                                                                
 4e0x(A) : HMMKEKWWR                                                                                                                
         :                                                                                                                          
 2pbw(A) : HMMKEKWW*                                                                                                                
           _________                                                                                                                

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue )
1
Moving Domain
( red )
2
Rotation Angle
(deg)
2.2
Translation
(A)
-0.1
Closure
(%)
99.7
Bending Residues
( green )
  10 - 11
  17 - 20
  33 - 36
  56 - 57
  62 - 63
  87 - 89
  100 - 101
  104 - 105
  107 - 108
  212 - 216
  225 - 226
  229 - 230
  232 - 233
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download