3C-Like Protease

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name 3C-Like Protease
  Conformer 1
(PDB) 		4in1 (A)
  Conformer 2
(PDB) 		2iph (A)
  Window Length 15
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 129 0.6   8 - 98   122 - 167
2 23 0.93   99 - 121

Sequence


           _________________________________________________________________________________________________98____________________1 
 4in1(A) : SAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSG 
         :                                                                                                                          
 2iph(A) : *APPTLWSRVTKFGSGWGFWVSPTVFITTTHVIPTSAKEFFGEPLTSIAIHRAGEFTLFRFSKKIRPDLTGMILEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSG 
           _______________________________________________________________________________________________1098___________________11 

           21____________________________________________________________                                                           
 4in1(A) : MLLT--------lGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGEINFE                                                           
         :                                                                                                                          
 2iph(A) : MLLTGANAKGMDLGTIPGDCGAPYVYKRANDWVVCGVHAAATKSGNTVVCAVQASEGETTL*                                                           
           21____________________________________________________________                                                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.9
Translation
(A) 		0.2
Closure
(%) 		69.9
Bending Residues
( green ) 		  98 - 99
  121 - 122
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download