Epidermal Growth Factor Receptor

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Epidermal Growth Factor Receptor
  Conformer 1
(PDB)
4i1z (A)
  Conformer 2
(PDB)
4wrg (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)
Residues
1 197 2.57   769 - 778   794 - 853   856 - 985
2 20 1.73   745 - 768   854 - 855
3 48 1.11   705 - 744   780 - 793

Sequence


           ________________________________________________744_____________________768___774________________793____________________ 
 4i1z(A) : *******QALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQY 
         :                                                                                                                          
 4wrg(A) : AMGEAPNQALLRILKETEFKKIKVLG-----tVYKGLWIPEGEKVKIPVAIKE-----sPK-nKEILDEAYVMASVDNPHVCRLLGICLTS-vQLITQLMPFG-lLDYVREHKDNIGSQY 
           ________________________________________________744_____________________768___774________________793____________________ 

           _____________________________________853________________________________________________________________________________ 
 4i1z(A) : LLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERL 
         :                                                                                                                          
 4wrg(A) : LLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAE--kVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERL 
           _____________________________________853________________________________________________________________________________ 

           ________________________________________________________________                                                         
 4i1z(A) : PQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERM**********                                                         
         :                                                                                                                          
 4wrg(A) : PQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDmDDVVDADEYLIP                                                         
           ________________________________________________________________                                                         

Morph

Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 30.1 0.6 5.7   768 - 772   853 - 856 Bending Region Analysis
1 3 37.0 0.8 91.9   774 - 780   793 - 795 Bending Region Analysis
3 2 21.5 0.0 58.9   744 - 745 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 3 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 3

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download