Glutamate Receptor, Ionotropic Kainate 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 1
  Conformer 1
(PDB) 		2f36 (A)
  Conformer 2
(PDB) 		6fqj (F)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 146 1.43   7 - 109   200 - 201   213 - 253
2 101 1.36   110 - 199   202 - 212

Sequence


           ________________________________________________________________________________________________________109_____________ 
 2f36(A) : *TLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQN-DKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPIDS 
         :                                                                                                                          
 6fqj(F) : KTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
           ________________________________________________________________________________________________________110_____________ 

           ____________________________________________________________________________199___________212___________________________ 
 2f36(A) : ADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTD--YALLMESTSIEYVTQRN-CNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQE 
         :                                                                                                                          
 6fqj(F) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVCGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
           ____________________________________________________________________________202___________216___________________________ 

           ____________________                                                                                                     
 2f36(A) : EGKLHMMKEKWWRGNG-CPS                                                                                                     
         :                                                                                                                          
 6fqj(F) : QGLLDKLKNKWWYDKGEC**                                                                                                     
           ____________________                                                                                                     

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		30.6
Translation
(A) 		0.5
Closure
(%) 		90.7
Bending Residues
( green ) 		  109 - 110
  199 - 202
  212 - 214
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download