Glutamate Receptor, Ionotropic Kainate 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 2
  Conformer 1
(PDB) 		2xxr (A)
  Conformer 2
(PDB) 		1yae (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 150 0.48   434 - 535   740 - 752   763 - 797
2 91 0.58   536 - 739   753 - 762

Sequence


           ________________________________________________________________________________________________________________535_____ 
 2xxr(A) : ***********SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI 
         :                                                                                                                          
 1yae(A) : PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI 
           ________________________________________________________________________________________________________________535_____ 

           ____________________________________________________________________________739______748___________762__________________ 
 2xxr(A) : LYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI 
         :                                                                                                                          
 1yae(A) : LYRK---iDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI 
           ____________________________________________________________________________739______748___________762__________________ 

           ________________________                                                                                                 
 2xxr(A) : AILQLQEEGKLHMMKEKWW*****                                                                                                 
         :                                                                                                                          
 1yae(A) : AILQLQEEGKLHMMKEKWWRGNGC                                                                                                 
           ________________________                                                                                                 

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		11.2
Translation
(A) 		0.2
Closure
(%) 		85.5
Bending Residues
( green ) 		  535 - 537
  739 - 740
  748 - 753
  762 - 763
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download