Heme Oxygenase-1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Heme Oxygenase-1
  Conformer 1
(PDB) 		1irm (C)
  Conformer 2
(PDB) 		1ix3 (A)
  Window Length 13
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 152 0.86   48 - 143   161 - 216
2 23 1.28   42 - 47   144 - 160

Sequence


           ___________________________________47___________________________________________________________________________________ 
 1irm(C) : *******************NSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLV 
         :                                                                                                                          
 1ix3(A) : QDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLV 
           ___________________________________47___________________________________________________________________________________ 

           _____138___________________160________________________________________________________________________                   
 1irm(C) : AHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEH*******                   
         :                                                                                                                          
 1ix3(A) : AHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTeFLRQRPASL                   
           _____138___________________160________________________________________________________________________                   

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		16.5
Translation
(A) 		0.4
Closure
(%) 		34.0
Bending Residues
( green ) 		  47 - 48
  138 - 146
  160 - 166
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download