Ferric Hydroxamate Receptor 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ferric Hydroxamate Receptor 2
  Conformer 1
(PDB) 		4fil (A)
  Conformer 2
(PDB) 		4fkm (A)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 104 0.89   133 - 138   160 - 276
2 96 1.2   52 - 131   139 - 159   277 - 294

Sequence


           __________________________________________________________________________________131____138__________________159_______ 
 4fil(A) : PKRIAVVAPTYAGGLKKLGANIVAVNQQVDQSKVLKDKFKGVTKIGDGDVEKVAKEKPDLIIVYSTDKDIAAYQAVAPTVVVDYNKHKYLEQQEMLGKIVGKEDKVKAWKKDWEETTAKD 
         :                                                                                                                          
 4fkm(A) : *PrIAVVAPTYAGGL--lGANIVAVNQQVDQS-vL--df-gVT-iGDGDVE-vAe--pDLIIVYSTD-dI--yQ-vAPTVVVDYN-h-yLEQQE-lG-iVG-eD--vaW--dWEETTA-d 
           __________________________________________________________________________________131____138__________________159_______ 

           ___________________________________________________________________________________________________________276__________ 
 4fil(A) : GKEIKKAIGQDATVSLFDEFDKKLYTYGDNWGRGGEVLYQAFGLKMQPEQQKLTAKAGWAEVKQEEIEKYAGDYIVSTSEGKPTPGYESTNMWKNLKATKEGHIVKVDAGTYWYNDPYTL 
         :                                                                                                                          
 4fkm(A) : G-eI--aIGQDATVSLFDEFD--lYTYGDNWGRGGEVLYQAFGL--qPEQQ-lTA-aGWAEV-qEEIE-yAGDYIVSTSEG-pTPGYESTN-w-nL-aT-eGHIV-vDAGTYWYNDPYTL 
           ___________________________________________________________________________________________________________276__________ 

           ________________                                                                                                         
 4fil(A) : DFMRKDLKEKLIKAAK                                                                                                         
         :                                                                                                                          
 4fkm(A) : DF--rdLelIaA****                                                                                                         
           ________________                                                                                                         

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		10.2
Translation
(A) 		0.0
Closure
(%) 		95.2
Bending Residues
( green ) 		  131 - 136
  138 - 139
  159 - 160
  276 - 277
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download