Glutamate Receptor, Ionotropic Kainate 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 2
  Conformer 1
(PDB) 		2xxr (A)
  Conformer 2
(PDB) 		5mfq (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 129 0.58   434 - 529   534 - 534   765 - 797
2 114 0.74   530 - 533   535 - 764

Sequence


           ________________________________________________________________________________________________529_533_________________ 
 2xxr(A) : *SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDS 
         :                                                                                                                          
 5mfq(A) : RTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQND-KGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPIDS 
           ________________________________________________________________________________________________529_533_________________ 

           __________________________________________________________________________________________763___________________________ 
 2xxr(A) : ADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGK 
         :                                                                                                                          
 5mfq(A) : ADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGK 
           __________________________________________________________________________________________763___________________________ 

           ______________                                                                                                           
 2xxr(A) : LHMMKEKWW*****                                                                                                           
         :                                                                                                                          
 5mfq(A) : LHMMKEKWWRGNGC                                                                                                           
           ______________                                                                                                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.0
Translation
(A) 		0.0
Closure
(%) 		92.6
Bending Residues
( green ) 		  529 - 530
  533 - 535
  763 - 765
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download