Ionotropic Glutamate Receptor 5

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ionotropic Glutamate Receptor 5
  Conformer 1
(PDB) 		2f35 (A)
  Conformer 2
(PDB) 		1yae (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 142 0.77   7 - 108   213 - 252
2 103 1.01   109 - 212

Sequence


           _______________________________________________________________________________________________________________108______ 
 2f35(A) : ********RTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQND-KGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILY 
         :                                                                                                                          
 1yae(B) : NITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILY 
           _______________________________________________________________________________________________________________536______ 

           _______________________________________________________________________________________________212______________________ 
 2f35(A) : RKGTPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAI 
         :                                                                                                                          
 1yae(B) : RKPN-iDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAI 
           _______________________________________________________________________________________________760______________________ 

           ______________________                                                                                                   
 2f35(A) : LQLQEEGKLHMMKEKWWRGN**                                                                                                   
         :                                                                                                                          
 1yae(B) : LQLQEEGKLHMMKEKWWRGNGC                                                                                                   
           ______________________                                                                                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		20.0
Translation
(A) 		0.3
Closure
(%) 		90.3
Bending Residues
( green ) 		  108 - 109
  212 - 213
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download