Guanylate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Guanylate Kinase
  Conformer 1
(PDB) 		1ex6 (A)
  Conformer 2
(PDB) 		1znw (A)
  Window Length 15
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 64 2.05   9 - 30   84 - 118   158 - 167
2 47 1.84   8 - 8   119 - 155   168 - 176
3 52 1.93   32 - 83

Sequence


           ________8____________________30_____________________________________________________83_________________________________1 
 1ex6(A) : *SRPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYY--GSTVASVKQVSKSGKTCILDIDMQGVKSVK-AIPELNAR 
         :                                                                                                                          
 1znw(A) : VGRVVVLSGPSAVGKSTVVRCLRERIPN-LHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPE--AV 
           _______28____________________49____________________________________________________104_________________________________1 

           18__________________________________155_________167___________________                                                   
 1ex6(A) : FLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYAETGAHDKVIVNDDLDKAYKELKDFIFAEK                                                   
         :                                                                                                                          
 1znw(A) : TVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELA--AQGDFDKVVVNRRLESACAELVSLLV***                                                   
           38__________________________________175_________185___________________                                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		21.1
Translation
(A) 		-0.3
Closure
(%) 		90.8
Bending Residues
( green ) 		  8 - 11
  118 - 119
  155 - 160
  167 - 168
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		22.2
Translation
(A) 		0.3
Closure
(%) 		47.7
Bending Residues
( green ) 		  30 - 34
  83 - 84
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download