Hemagglutinin Ha2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Hemagglutinin Ha2
  Conformer 1
(PDB) 		1ken (B)
  Conformer 2
(PDB) 		1htm (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 36 3.9   70 - 105
2 21 3.56   43 - 63
3 46 6.45   106 - 151

Sequence


           _____________________________________________________________63_______________________________________105_______________ 
 1ken(B) : GLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFE 
         :                                                                                                                          
 1htm(B) : ***************************************STQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFE 
           _____________________________________________________________63_______________________________________105_______________ 

           _______________________________________________________                                                                  
 1ken(B) : KTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKG                                                                  
         :                                                                                                                          
 1htm(B) : KTRRQLRENAEEMGNGCFKIYHKCDNACIESIR**********************                                                                  
           _______________________________________________________                                                                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		173.5
Translation
(A) 		8.0
Closure
(%) 		86.9
Bending Residues
( green ) 		  63 - 75
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		160.4
Translation
(A) 		-9.3
Closure
(%) 		95.0
Bending Residues
( green ) 		  105 - 108
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download