Inorganic Pyrophosphatase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Inorganic Pyrophosphatase
  Conformer 1
(PDB) 		3d63 (A)
  Conformer 2
(PDB) 		3gvf (A)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 33 1.29   25 - 25   48 - 52   94 - 104   139 - 154
2 113 0.49   6 - 24   26 - 26   53 - 93   105 - 138   155 - 172
3 21 0.69   27 - 47

Sequence


           ____________________23_____________________46___51________________________________________93________104_________________ 
 3d63(A) : *FSNVPAGKDLPQDFNVIIEIPAQSEPVKYEADKALGLLVVDRFIGTGMRYPVNYGFIPQTLSGDGDPVDVLVITPFPLLAGSVVRARALGMLKMTDESGVDAKLVAVPHDKVCPMTANL 
         :                                                                                                                          
 3gvf(A) : SFSNVPAGKDLPQDFNVIIEIPAQSEPVKYEADKALGLLVVDRFIGTGMRYPVNYGFIPQTLSGDGDPVDVLVITPFPLLAGSVVRARALGMLKMTDESGVDAKLVAVPHDKVCPMTANL 
           ____________________23_____________________46___51________________________________________93________104_________________ 

           ______________138_____________154_____________________                                                                   
 3d63(A) : KSIDDVPAYLKDQIKHFFEQYKALEKGKWVKVEGWDGIDAAHKEITDGVANFKK                                                                   
         :                                                                                                                          
 3gvf(A) : KSIDDVPAYLKDQIKHFFEQYKALEKGKWVKVEGWDGIDAAHKEITDGVANFKK                                                                   
           ______________138_____________154_____________________                                                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		12.2
Translation
(A) 		0.5
Closure
(%) 		94.8
Bending Residues
( green ) 		  23 - 26
  51 - 55
  93 - 94
  104 - 106
  138 - 139
  154 - 156
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		38.5
Translation
(A) 		0.7
Closure
(%) 		78.8
Bending Residues
( green ) 		  25 - 28
  46 - 48
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download