Mediator Of DNA Damage Checkpoint Protein 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Mediator Of DNA Damage Checkpoint Protein 1
  Conformer 1
(PDB) 		2etx (B)
  Conformer 2
(PDB) 		3k05 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 114 0.67   1893 - 1994   2012 - 2019   2072 - 2075
2 75 0.67   1995 - 2011   2020 - 2071   2076 - 2081

Sequence


           ___________________________________________________________________________________________________1993______________201 
 2etx(B) : TAPKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPP 
         :                                                                                                                          
 3k05(A) : TAPKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPP 
           ___________________________________________________________________________________________________1993______________201 

           1____2019________________________________________________2071______________                                              
 2etx(B) : PPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLSPLE                                              
         :                                                                                                                          
 3k05(A) : PPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLDGVLKQEAKPEAFVLSP**                                              
           1____2019________________________________________________2071______________                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.5
Translation
(A) 		-0.2
Closure
(%) 		85.6
Bending Residues
( green ) 		  1993 - 1995
  2011 - 2012
  2019 - 2020
  2071 - 2072
  2075 - 2076
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download