Mediator Of DNA Damage Checkpoint Protein 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Mediator Of DNA Damage Checkpoint Protein 1
  Conformer 1
(PDB) 		2etx (A)
  Conformer 2
(PDB) 		3k05 (A)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 92 0.75   1897 - 1933   1939 - 1993
2 90 0.75   1934 - 1938   1994 - 2078

Sequence


           _______________________________________1933_1938___________________________________________________1993_________________ 
 2etx(A) : *APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPP 
         :                                                                                                                          
 3k05(A) : TAPKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPP 
           _______________________________________1933_1938___________________________________________________1993_________________ 

           ___________________________________________________________________________                                              
 2etx(A) : PPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLSPLE                                              
         :                                                                                                                          
 3k05(A) : PPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLDGVLKQEAKPEAFVLSP**                                              
           ___________________________________________________________________________                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.1
Translation
(A) 		0.1
Closure
(%) 		96.7
Bending Residues
( green ) 		  1933 - 1934
  1938 - 1939
  1993 - 1994
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download