Nitrate/nitrite Response Regulator Protein Narl

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Nitrate/nitrite Response Regulator Protein Narl
  Conformer 1
(PDB) 		1rnl  
  Conformer 2
(PDB) 		1je8 (B)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 21 8.14   43 - 47   70 - 72   77 - 91
2 21 6.2   48 - 65   73 - 76

Sequence


           ________________________________________46_________________65_____72__76________________________________________________ 
 1rnl    : EPATILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAA 
         :                                                                                                                          
 1je8(B) : **********************************RDVNQLTPRERDILKLIAQGLPNK-iARRLDITESTVKVHVKHl--KKkLKSRVEAAVWVHQERIF******************** 
           _______________________________________158________________177____184_188________________________________________________ 

           ________________________________________________________________________________                                         
 1rnl    : AGEMVLSEALTPVLAASLqLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERIF                                         
         :                                                                                                                          
 1je8(B) : ********************************************************************************                                         
           ________________________________________________________________________________                                         

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		96.0
Translation
(A) 		3.0
Closure
(%) 		5.6
Bending Residues
( green ) 		  46 - 48
  65 - 70
  72 - 73
  76 - 77
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download