P58-Cl42 Kir

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name P58-Cl42 Kir
  Conformer 1
(PDB) 		1nkr (A)
  Conformer 2
(PDB) 		1im9 (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 107 0.79   15 - 18   69 - 71   99 - 198
2 83 1.08   9 - 14   19 - 68   72 - 98

Sequence


           _______14__18________________________________________________68_71_________________________98___________________________ 
 1nkr(A) : RKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVT 
         :                                                                                                                          
 1im9(D) : RKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVT 
           _______14__18________________________________________________68_71_________________________98___________________________ 

           ___________________________________________________________________________                                              
 1nkr(A) : LSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVT                                              
         :                                                                                                                          
 1im9(D) : LSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVT                                              
           ___________________________________________________________________________                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		14.0
Translation
(A) 		0.3
Closure
(%) 		64.1
Bending Residues
( green ) 		  14 - 15
  18 - 19
  68 - 69
  71 - 72
  98 - 99
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download