Peptidyl-Prolyl Cis-Trans Isomerase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Peptidyl-Prolyl Cis-Trans Isomerase
  Conformer 1
(PDB) 		1pin (A)
  Conformer 2
(PDB) 		1yw5 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 118 2.43   39 - 161
2 31 1.5   8 - 38

Sequence


           ___________________________________36___________________________________________________________________________________ 
 1pin(A) : ******KLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGg------------KNGQGEP-----ARVRCSHLLVKHSQSRRPSSWRQ-EKITRTKEEALELINGYIQKIKSGEEDFESL 
         :                                                                                                                          
 1yw5(A) : MASTSTGLPPNWTIRVSRSHNKEYFLNQSTNESSWDPPYGTDKEVLNAYIAKFKNNGYKPLVNEDGQVRVSHLLIKNNQSRKPKSWKSPDGISRTRDESIQILKKHLERILSGEVKLSEL 
           ___________________________________37___________________________________________________________________________________ 

           _________________________________________________________                                                                
 1pin(A) : ASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE                                                                
         :                                                                                                                          
 1yw5(A) : ANTESDCSSHDRGGDLGFFSKGQMQPPFEEAAFNLHVGEVSNIIETNSGVHILQRTG                                                                
           _________________________________________________________                                                                

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		105.2
Translation
(A) 		-10.9
Closure
(%) 		97.9
Bending Residues
( green ) 		  36 - 51
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download