Potassium Channel

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Potassium Channel
  Conformer 1
(PDB) 		2wln (A)
  Conformer 2
(PDB) 		2wlk (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 186 1.74   14 - 40   133 - 296
2 92 0.5   41 - 132

Sequence


           ______________26______________________________________________________________________________________________________13 
 2wln(A) : *PRILNSDGSSNITRLG-----wLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARPGSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASL 
         :                                                                                                                          
 2wlk(A) : KPRILNSDGSSNITRLGLEKRGWLDDHYHDLLTVSWPVFITLITGLYLVTNALFALAYLACGDVIENARPGSFTDAFFFSVQTMATIGYGKLIPIGPLANTLVTLEALCGMLGLAVAASL 
           ______________26______________________________________________________________________________________________________13 

           1_______________________________________________________________________________________________________________________ 
 2wln(A) : IYARFTRPTAGVLFSSRMVISDFEGKPTLMMRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFLVLFTGHHEAF 
         :                                                                                                                          
 2wlk(A) : IYARFTrPTAGVLFSSRMVISDFEGKPTLMMRLANLRIEQIIEADVHLVLVRSEISQEGMVFRRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPIYGETDETLRNSHSEFLVLFTGHHEAF 
           1_______________________________________________________________________________________________________________________ 

           ___________________________________________________                                                                      
 2wln(A) : AQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRAIDLGKFHEIAQHHHH**                                                                      
         :                                                                                                                          
 2wlk(A) : AQNVHARHAYSCDEIIWGGHFVDVFTTLPDGRRALDLGKFHEIAQHHHHHH                                                                      
           ___________________________________________________                                                                      

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		23.9
Translation
(A) 		0.4
Closure
(%) 		10.8
Bending Residues
( green ) 		  26 - 41
  131 - 133
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download