Redox-Sensing Transcriptional Repressor Rex

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Redox-Sensing Transcriptional Repressor Rex
  Conformer 1
(PDB) 		3keq (A)
  Conformer 2
(PDB) 		3keo (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 112 0.6   79 - 193
2 64 0.62   8 - 78

Sequence


           _______________________________________________________________________78_______________________________________________ 
 3keq(A) : SIPKATAKRLSLYYRIFKRFNTDGIEKASSKQIADALGIDSATVRRDFSYFGE-------yDVKKLMNFFAEILN---tTNVMLVGCGNIGRALLHYRFHDRNKMQISMAFDLDSNDLVG 
         :                                                                                                                          
 3keo(B) : SIPKATAKRLSLYYRIFKRFNTDGIEKASSKQIADALGIDSATVRRDFSYFGELGRRGFGYDVKKLMNFFAEILNDHSTTNVMLVGCGNIGRALLHYRFHDRNKMQISMAFDLDSNDLVG 
           _______________________________________________________________________78_______________________________________________ 

           _______________________________________________________________________________________                                  
 3keq(A) : KTTEDGIPVYGISTINDHLIDSDIETAILTVPSTEAQEVADILVKAGIKGILSFSPVHLTLPKDIIVQYVDLTSELQTLLYFMNQQ*                                  
         :                                                                                                                          
 3keo(B) : KTTEDGIPVYGISTINDHLIDSDIETAILTVPSTEAQEVADILVKAGIKGILSFSPVHLTLPKDIIVQYVDLTSELQTLLYFMNQQR                                  
           _______________________________________________________________________________________                                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.7
Translation
(A) 		0.1
Closure
(%) 		7.9
Bending Residues
( green ) 		  78 - 86
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download