Sialic Acid-Binding Periplasmic Protein Siap

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Sialic Acid-Binding Periplasmic Protein Siap
  Conformer 1
(PDB) 		3b50 (A)
  Conformer 2
(PDB) 		2cey (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 141 0.45   4 - 77   100 - 123   213 - 253   303 - 304
2 50 0.47   78 - 99   124 - 126   210 - 212   281 - 302
3 109 0.68   127 - 209   255 - 280

Sequence


           ___________________________________________________________________________77____________________99_____________________ 
 3b50(A) : ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLS 
         :                                                                                                                          
 2cey(A) : ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLS 
           ___________________________________________________________________________77____________________99_____________________ 

           123____________________________________________________________________________________210______________________________ 
 3b50(A) : QAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAEN 
         :                                                                                                                          
 2cey(A) : QAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAEN 
           123____________________________________________________________________________________210______________________________ 

           _______250___________________________280___________________302________                                                   
 3b50(A) : AAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPKGEA                                                   
         :                                                                                                                          
 2cey(A) : AAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINP****                                                   
           _______250___________________________280___________________302________                                                   

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Fixed Domain Moving Domain Rotation Angle Translation   (A) Closure Bending Residues  
1 2 6.9 0.3 68.5   77 - 78   99 - 100   123 - 124   210 - 213   302 - 303 Bending Region Analysis
1 3 29.6 0.1 99.9   250 - 255 Bending Region Analysis
3 2 22.8 0.2 60.7   125 - 127   209 - 212   280 - 282 Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 3 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 3

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download