Translin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Translin
  Conformer 1
(PDB) 		1j1j (A)
  Conformer 2
(PDB) 		4jhf (F)
  Window Length 15
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 139 0.44   8 - 148   193 - 196
2 58 0.37   149 - 192   197 - 210

Sequence


           ________________________________________________________________________________________________________________________ 
 1j1j(A) : *MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGFQDIPKRCLKAREHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAV 
         :                                                                                                                          
 4jhf(F) : SMSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVH------dIPKRCLKAREHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAV 
           ________________________________________________________________________________________________________________________ 

           __________________________148_________________________________________192_________________________                       
 1j1j(A) : TEILGIEPDREKGFHLDVEDYLSGVLILASELSRLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYDGLKYDVKKVEEVVYDLSIRGF                       
         :                                                                                                                          
 4jhf(F) : TEILGIEPDREKGFHLDVEDYLSGVLILASELSRLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYDGLKYDVKKVEEVVYDLSIRGF                       
           __________________________148_________________________________________192_________________________                       

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		3.6
Translation
(A) 		-0.4
Closure
(%) 		32.6
Bending Residues
( green ) 		  148 - 149
  192 - 197
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download