Transcriptional Regulator

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Transcriptional Regulator
  Conformer 1
(PDB) 		2yvh (B)
  Conformer 2
(PDB) 		2zoz (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 106 1.1   58 - 91   95 - 103   109 - 172
2 59 0.64   5 - 57   92 - 94   104 - 108

Sequence


           _____________________________________________________57_____________________________88____________103__108______________ 
 2yvh(B) : TSKKE-iLRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLG-hELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIP 
         :                                                                                                                          
 2zoz(A) : TSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIP 
           _____________________________________________________57_____________________________88____________103__108______________ 

           ____________________________________________________                                                                     
 2yvh(B) : DTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQA-lETILELIP                                                                     
         :                                                                                                                          
 2zoz(A) : DTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIP                                                                     
           ____________________________________________________                                                                     

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		11.8
Translation
(A) 		0.9
Closure
(%) 		90.6
Bending Residues
( green ) 		  57 - 58
  88 - 95
  103 - 105
  108 - 109
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download