Troponin C

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Troponin C
  Conformer 1
(PDB) 		4tnc (A)
  Conformer 2
(PDB) 		2tn4 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 123 2.23   6 - 38   67 - 156
2 28 1.34   39 - 66

Sequence


           __________________________________38__________________________66________________________________________________________ 
 4tnc(A) : AMDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELADCFRIFDKNADGFIDIEELGEIL 
         :                                                                                                                          
 2tn4(A) : *TDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAELFRIFDRNADGYIDAEELAEIF 
           __________________________________35__________________________63________________________________________________________ 

           ________________________________________                                                                                 
 4tnc(A) : RATGEHVTEEDIEDLMKDSDKNNDGRIDFDEFLKMMEGVQ                                                                                 
         :                                                                                                                          
 2tn4(A) : RASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMM****                                                                                 
           ________________________________________                                                                                 

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		48.3
Translation
(A) 		1.7
Closure
(%) 		98.4
Bending Residues
( green ) 		  38 - 41
  66 - 73
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download