Tryptophan 2,3-Dioxygenase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Tryptophan 2,3-Dioxygenase
  Conformer 1
(PDB) 		6ud5 (A)
  Conformer 2
(PDB) 		4pw8 (A)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 260 1.38   45 - 233   272 - 378
2 38 0.48   234 - 271

Sequence


           ________________________________________________________________________________________________________________________ 
 6ud5(A) : GLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQF 
         :                                                                                                                          
 4pw8(A) : **IYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQF 
           ________________________________________________________________________________________________________________________ 

           ________________________________________________________________________233___________________________________271_______ 
 6ud5(A) : RLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLS 
         :                                                                                                                          
 4pw8(A) : RLLENKIGVLQ-----------------eENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLS 
           ________________________________________________________________________233___________________________________271_______ 

           _______________________________________________________________________________________________________________          
 6ud5(A) : KGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFL          
         :                                                                                                                          
 4pw8(A) : KGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGS-------------------rYKVFVDLFNLSTYLIPRHWIPKMN*******          
           _______________________________________________________________________________________________________________          

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		14.9
Translation
(A) 		-0.1
Closure
(%) 		29.9
Bending Residues
( green ) 		  233 - 234
  271 - 272
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download