Xylanase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Xylanase
  Conformer 1
(PDB) 		1xnb (A)
  Conformer 2
(PDB) 		2b42 (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 140 0.47   4 - 69   80 - 107   130 - 158   167 - 183
2 40 0.78   70 - 79   108 - 129   159 - 166

Sequence


           ___________________________________________________________________69________79_________________________107_____________ 
 1xnb(A) : ASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDG 
         :                                                                                                                          
 2b42(B) : *STDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDG 
           ___________________________________________________________________69________79_________________________107_____________ 

           ______129__________________________158_____166___________________                                                        
 1xnb(A) : DRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW                                                        
         :                                                                                                                          
 2b42(B) : DRTTFTQYWSVRQSKRPTGSNATITFTNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW                                                        
           ______129__________________________158_____166___________________                                                        

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		10.9
Translation
(A) 		-0.2
Closure
(%) 		99.0
Bending Residues
( green ) 		  69 - 70
  79 - 80
  107 - 108
  129 - 130
  158 - 159
  166 - 167
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download