Flagellar Motor Switch Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Flagellar Motor Switch Protein
  Conformer 1
(PDB) 		3usy (A)
  Conformer 2
(PDB) 		3usw (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 41 0.54   205 - 245
2 78 1.85   120 - 204
3 88 0.3   246 - 333

Sequence


           ___________________________________________________________________________________195__________________________________ 
 3usy(A) : GPLGSMQKNFAYLGKIKPQQLADFIINEHPQTIALILAHMEAPNAAETLSYFPDEMKAEISIRMANLGEISPQVVKRVSTVLENKLESLTSYKIEVGGLRAVAEIFNRLGQKSAKTTLAR 
         :                                                                                                                          
 3usw(A) : *******KNFAYLGKIKPQQLADFIINEHPQTIALILAHMEAPNAAETLSYFPDEMKAEISIRMANLGEISPQVVKRVSTVLENKLE-------eVGGLRAVAEIFNRLGQKSAKTTLAR 
           ___________________________________________________________________________________195__________________________________ 

           _____________245___________________________________________________________________________________________              
 3usy(A) : IESVDNKLAGAIKEMMFTFEDIVKLDNFAIREILKVADKKDLSLALKTSTKDLTDKFLNNMSSRAAEQFVEEMQYLGAVKIKDVDVAQRKIIEIVQSLQEKGVIQTG              
         :                                                                                                                          
 3usw(A) : IESVDNKLAGAIKEMMFTFEDIVKLDNFAIREILKVADKKDLSLALKTSTKDLTDKFLNNMSSRAAEQFVEEMQYLGAVKIKDVDVAQRKIIEIVQSLQEKGVIQT*              
           _____________245___________________________________________________________________________________________              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		174.5
Translation
(A) 		-4.4
Closure
(%) 		92.7
Bending Residues
( green ) 		  195 - 206
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		178.2
Translation
(A) 		0.2
Closure
(%) 		13.3
Bending Residues
( green ) 		  245 - 246
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download