Peptidyl-Prolyl Cis-Trans Isomerase Slyd

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Peptidyl-Prolyl Cis-Trans Isomerase Slyd
  Conformer 1
(PDB) 		4odl (B)
  Conformer 2
(PDB) 		4odo (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 21 0.31   38 - 38   57 - 65   117 - 127
2 74 0.38   3 - 37   39 - 56   128 - 148
3 51 0.87   66 - 116

Sequence


           __________________________________36_________________55________65________________________________________________116____ 
 4odl(B) : MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHP 
         :                                                                                                                          
 4odo(A) : MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHP 
           __________________________________36_________________55________65________________________________________________116____ 

           ____127_______________________                                                                                           
 4odl(B) : LAGKDLDFQVEVVKVREATPEELLHGHAHP                                                                                           
         :                                                                                                                          
 4odo(A) : LAGKDLDFQVEVVKVREATPEELLHGHAHP                                                                                           
           ____127_______________________                                                                                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.8
Translation
(A) 		-0.2
Closure
(%) 		98.8
Bending Residues
( green ) 		  36 - 39
  55 - 57
  127 - 128
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		15.5
Translation
(A) 		-0.7
Closure
(%) 		21.9
Bending Residues
( green ) 		  65 - 66
  116 - 118
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download