Ribonuclease A

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ribonuclease A
  Conformer 1
(PDB) 		1jvu (A)
  Conformer 2
(PDB) 		1jvt (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 77 0.16   3 - 23   48 - 81   101 - 122
2 43 0.19   24 - 47   82 - 100

Sequence


           _________________19__________________________47________________________________81________________100____________________ 
 1jvu(A) : KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHF 
         :                                                                                                                          
 1jvt(A) : KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHF 
           _________________19__________________________47________________________________81________________100____________________ 

           ____                                                                                                                     
 1jvu(A) : DASV                                                                                                                     
         :                                                                                                                          
 1jvt(A) : DASV                                                                                                                     
           ____                                                                                                                     

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		2.1
Translation
(A) 		0.0
Closure
(%) 		89.0
Bending Residues
( green ) 		  19 - 25
  47 - 48
  81 - 82
  100 - 101
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download