Glutamate Receptor, Ionotropic Kainate 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 2
  Conformer 1
(PDB) 		4mh5 (A)
  Conformer 2
(PDB) 		4e0x (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 126 0.56   8 - 107   216 - 238   249 - 251
2 118 0.84   108 - 215   239 - 248

Sequence


           ______________________________________________________________________________________________________107_______________ 
 4mh5(A) : GTNRSLIVTTLLEEPFVMFRKSDRTLYGNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKGQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKGTPI 
         :                                                                                                                          
 4e0x(A) : ***RTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPI 
           ______________________________________________________________________________________________________105_______________ 

           ___________________________________________________________________________________________215____________________238___ 
 4mh5(A) : DSADDLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMWAFMSSKP-SALVKNNEEGIQRTLTADYALLMESTTIEYITQRNCNLTQIGGLIDSKGYGIGTPMGSPYRDKITIAILQLQEE 
         :                                                                                                                          
 4e0x(A) : DSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEE 
           ___________________________________________________________________________________________214____________________237___ 

           ____248__________                                                                                                        
 4mh5(A) : DKLHIMKEKWWRGSGCP                                                                                                        
         :                                                                                                                          
 4e0x(A) : GKLHMMKEKWWR*****                                                                                                        
           ____247__________                                                                                                        

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.3
Translation
(A) 		0.0
Closure
(%) 		98.8
Bending Residues
( green ) 		  107 - 108
  215 - 216
  238 - 242
  248 - 249
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download