Maf-Like Protein Ycef

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Maf-Like Protein Ycef
  Conformer 1
(PDB) 		4p0u (B)
  Conformer 2
(PDB) 		4p0e (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 126 0.8   5 - 78   103 - 123   140 - 142   144 - 144   152 - 155   163 - 185
2 55 0.31   79 - 102   124 - 139   143 - 143   145 - 151   156 - 162

Sequence


           __________________________________________________________________________78_____________________102__________________12 
 4p0u(B) : SLYLASGSPRRQELLAQLGVTFERIVTGIEAQRQPQESAQQYVVRLAREKARAGVAQTAKDLPVLGADTIVILNGEVLEKPRDAEHAAQMLRKLSGQTHQVMTAVALADSQHILDCLVVT 
         :                                                                                                                          
 4p0e(B) : SLYLASGSPRRQELLAQLGVTFERIVTGIEAQRQPQESAQQYVVRLAREKARAGVAQTAKDLPVLGADTIVILNGEVLEKPRDAEHAAQMLRKLSGQTHQVMTAVALADSQHILDCLVVT 
           __________________________________________________________________________78_____________________102__________________12 

           3_____________139_________151_155____162______________________________                                                   
 4p0u(B) : DVTFRTLTDEDIAGYVASDEPLDKAGAYGIQGLGGCFVRKINGSYHAVVGLPLVETYELLSNFNALREKR                                                   
         :                                                                                                                          
 4p0e(B) : DVTFRTLTDEDIAGYVASDEPLDKAGAYGIQGLGGCFVRKINGSYHAVVGLPLVETYELLSNFNALRE**                                                   
           3_____________139_________151_155____162______________________________                                                   

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		5.7
Translation
(A) 		0.0
Closure
(%) 		94.7
Bending Residues
( green ) 		  78 - 82
  102 - 103
  123 - 124
  139 - 140
  142 - 147
  151 - 152
  155 - 156
  162 - 163
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download