Myosin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Myosin
  Conformer 1
(PDB) 		1br1 (B)
  Conformer 2
(PDB) 		1y6w (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 70 4.26   5 - 83
2 61 3.52   84 - 145

Sequence


           _____________________________________________________________________________80_________________________________________ 
 1br1(B) : *FSEEQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVMKVLGNPKSDEMNLKTLKFEQFLPMMQTIAKNKDQGCFEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTE 
         :                                                                                                                          
 1y6w(A) : QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTV-rSLGCNPTEAELQDi--NEVDADGN-GTINFPEFLT-----aRCkDTDSEEEIREAFRVFDKDGNGYISAAELRHV-tNLGEKLTD 
           _____________________________________________________________________________77_________________________________________ 

           _____________________________                                                                                            
 1br1(B) : EEVEQLVAGHEDSNGCINYEELVRMVLSG                                                                                            
         :                                                                                                                          
 1y6w(A) : EEVDEiREADIDGDGQVNYEEFVQtA***                                                                                            
           _____________________________                                                                                            

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		136.4
Translation
(A) 		14.2
Closure
(%) 		6.1
Bending Residues
( green ) 		  80 - 85
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download