Protease (Retropepsin)

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Protease (Retropepsin)
  Conformer 1
(PDB) 		3bva (A)
  Conformer 2
(PDB) 		1kzk (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 64 0.33   3 - 31   41 - 44   56 - 74   84 - 95
2 29 0.49   32 - 40   45 - 55   75 - 83

Sequence


           _____________________________31_______40_____________55_________________74_______83________________                      
 3bva(A) : PQITLWKRPLVTIKIGGQLKEALLNTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF                      
         :                                                                                                                          
 1kzk(A) : PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF                      
           _____________________________31_______40_____________55_________________74_______83________________                      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		6.1
Translation
(A) 		0.0
Closure
(%) 		42.4
Bending Residues
( green ) 		  31 - 32
  40 - 45
  55 - 58
  74 - 75
  83 - 84
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download