Saposin B

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Saposin B
  Conformer 1
(PDB) 		1n69 (B)
  Conformer 2
(PDB) 		1n69 (C)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 44 1.14   3 - 25   56 - 76
2 30 0.99   26 - 55

Sequence


           ____________________20_________________________________55_______________________                                         
 1n69(B) : MDGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCD                                         
         :                                                                                                                          
 1n69(C) : **GDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCD                                         
           ____________________20_________________________________55_______________________                                         

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		26.9
Translation
(A) 		1.2
Closure
(%) 		30.6
Bending Residues
( green ) 		  20 - 26
  55 - 60
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download