Mediator Of DNA Damage Checkpoint Protein 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Mediator Of DNA Damage Checkpoint Protein 1
  Conformer 1
(PDB) 		2etx (B)
  Conformer 2
(PDB) 		2azm (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 155 0.73   1893 - 2001   2011 - 2038   2058 - 2077
2 34 0.96   2002 - 2010   2039 - 2057   2078 - 2083

Sequence


           ___________________________________________________________________________________________________________2001_____2010 
 2etx(B) : TAPKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPP 
         :                                                                                                                          
 2azm(B) : TAPKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPP 
           ___________________________________________________________________________________________________________2001_____2010 

           ________________________2038_______________2057________________2077________                                              
 2etx(B) : PPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLSPLE                                              
         :                                                                                                                          
 2azm(B) : PPQ-gEIISCCGGTYLPS-pRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLSPLE                                              
           ________________________2038_______________2057________________2077________                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		12.5
Translation
(A) 		0.4
Closure
(%) 		87.7
Bending Residues
( green ) 		  2001 - 2002
  2010 - 2011
  2038 - 2039
  2057 - 2058
  2077 - 2078
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download