Methylenetetrahydrofolate Dehydrogenase / Methenyltetrahydrofolate Cyclohydrolase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Methylenetetrahydrofolate Dehydrogenase / Methenyltetrahydrofolate Cyclohydrolase
  Conformer 1
(PDB) 		1a4i (B)
  Conformer 2
(PDB) 		1a4i (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 156 0.45   4 - 16   127 - 279
2 124 0.37   17 - 126   280 - 293

Sequence


           _____________16_________________________________________________________________________________________________________ 
 1a4i(B) : APAEILNGKEISAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLYINVKLKAAEEIGIKATHIKLPRTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPE 
         :                                                                                                                          
 1a4i(A) : APAEILNGKEISAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLYINVKLKAAEEIGIKATHIKLPRTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPE 
           _____________16_________________________________________________________________________________________________________ 

           __126___________________________________________________________________________________________________________________ 
 1a4i(B) : KDVDGLTSINAGRLARGDLNDCFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINYV 
         :                                                                                                                          
 1a4i(A) : KDVDGLTSINAGRLARGDLNDCFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINY- 
           __126___________________________________________________________________________________________________________________ 

           ___________________________________279_________________                                                                  
 1a4i(B) : PDDKKPNGRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRFLE                                                                  
         :                                                                                                                          
 1a4i(A) : ---------kVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRFLE                                                                  
           ___________________________________279_________________                                                                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		12.7
Translation
(A) 		0.4
Closure
(%) 		97.4
Bending Residues
( green ) 		  16 - 18
  126 - 127
  279 - 280
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download