Mycoplasma Arthritidis Mitogen

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Mycoplasma Arthritidis Mitogen
  Conformer 1
(PDB) 		2icw (H)
  Conformer 2
(PDB) 		1r5i (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 130 0.54   3 - 63   68 - 125   140 - 142   204 - 211
2 79 0.76   64 - 67   126 - 139   143 - 203

Sequence


           ______________________________________________________________63__67____________________________________________________ 
 2icw(H) : *MKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLS 
         :                                                                                                                          
 1r5i(D) : SMKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLS 
           ______________________________________________________________63__67____________________________________________________ 

           __124____________139__________________________________________________________200_____________                           
 2icw(H) : YFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED                           
         :                                                                                                                          
 1r5i(D) : YFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED                           
           __124____________139__________________________________________________________200_____________                           

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.4
Translation
(A) 		0.3
Closure
(%) 		5.5
Bending Residues
( green ) 		  63 - 64
  67 - 68
  124 - 126
  139 - 143
  200 - 206
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download