Nucleoside Diphosphate Kinase, Cytosolic

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Nucleoside Diphosphate Kinase, Cytosolic
  Conformer 1
(PDB) 		1pae (X)
  Conformer 2
(PDB) 		1b4s (A)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 99 0.68   14 - 42   78 - 150
2 35 0.61   43 - 77

Sequence


           ___________________________________42_________________________________77________________________________________________ 
 1pae(X) : **KERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVA-vFEGKGVVASARL-iGVTNPLASAPGSIRGDFGVDVGRNIIg-SD 
         :                                                                                                                          
 1b4s(A) : VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIGGSD 
           ___________________________________42_________________________________77________________________________________________ 

           ______________________________                                                                                           
 1pae(X) : SVESANREIALWFKPEELLTEVKPNPNLYE                                                                                           
         :                                                                                                                          
 1b4s(A) : SVESANREIALWFKPEELLTEVKPNPNLYE                                                                                           
           ______________________________                                                                                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		5.3
Translation
(A) 		-0.1
Closure
(%) 		60.7
Bending Residues
( green ) 		  42 - 43
  77 - 78
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download