Nuclear Factor Of Activated T-Cells, Cytoplasmic 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Nuclear Factor Of Activated T-Cells, Cytoplasmic 2
  Conformer 1
(PDB) 		1owr (Q)
  Conformer 2
(PDB) 		1a02 (N)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 169 1.5   405 - 573
2 103 0.67   574 - 676

Sequence


           ________________________________________________________________________________________________________________________ 
 1owr(Q) : VPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATID 
         :                                                                                                                          
 1a02(N) : ****WPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATID 
           ________________________________________________________________________________________________________________________ 

           ________________________________________________________573_____________________________________________________________ 
 1owr(Q) : CAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQ 
         :                                                                                                                          
 1a02(N) : CAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQ 
           ________________________________________________________573_____________________________________________________________ 

           ____________________________________________                                                                             
 1owr(Q) : PNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV                                                                             
         :                                                                                                                          
 1a02(N) : PNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV                                                                             
           ____________________________________________                                                                             

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		23.5
Translation
(A) 		2.2
Closure
(%) 		64.9
Bending Residues
( green ) 		  573 - 574
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download