Nuclear Factor-Kappa-B P52

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Nuclear Factor-Kappa-B P52
  Conformer 1
(PDB) 		1a3q (B)
  Conformer 2
(PDB) 		1a3q (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 178 0.37   39 - 222
2 103 0.51   223 - 325

Sequence


           ________________________________________________________________________________________________________________________ 
 1a3q(B) : GPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQR 
         :                                                                                                                          
 1a3q(A) : GPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQR 
           ________________________________________________________________________________________________________________________ 

           _________________________________________________________222____________________________________________________________ 
 1a3q(B) : QRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRsLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVH 
         :                                                                                                                          
 1a3q(A) : QRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRsLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVH 
           _________________________________________________________222____________________________________________________________ 

           _____________________________________________                                                                            
 1a3q(B) : KQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYP                                                                            
         :                                                                                                                          
 1a3q(A) : KQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYP                                                                            
           _____________________________________________                                                                            

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.2
Translation
(A) 		-1.5
Closure
(%) 		87.3
Bending Residues
( green ) 		  222 - 223
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download