Obelin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Obelin
  Conformer 1
(PDB) 		1sl7 (A)
  Conformer 2
(PDB) 		2f8p (A)
  Window Length 15
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 118 1.07   18 - 133   175 - 176
2 25 1.09   150 - 174

Sequence


           ________________________________________________________________________________________________________________________ 
 1sl7(A) : *********TDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDI 
         :                                                                                                                          
 2f8p(A) : ASKYAVKLKTDFDNPRWIKRHKHMFDFLDINGNGKITLDEIVSKASDDICAKLEATPEQTKRHQVCVEAFFRGCGMEYGKEIAFPQFLDGWKQLATSELKKWARNEPTLIREWGDAVFDI 
           ________________________________________________________________________________________________________________________ 

           ______130_________________________________________174_________________                                                   
 1sl7(A) : FDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDDSGDLDVDEMTRQHLGFWYTLD********                                                   
         :                                                                                                                          
 2f8p(A) : FDKDGSGTITLDEWKAYGKISGISPSQEDCEATFRHCDLDNSGDLDVDEMTRQHLGFWYTLDPEADGLYG                                                   
           ______130_________________________________________174_________________                                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.7
Translation
(A) 		-0.7
Closure
(%) 		57.1
Bending Residues
( green ) 		  130 - 150
  174 - 176
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download