Pc283 Immunoglobulin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Pc283 Immunoglobulin
  Conformer 1
(PDB) 		1kcr (H)
  Conformer 2
(PDB) 		1kcu (H)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 114 0.55   3 - 116
2 99 1.3   117 - 215

Sequence


           _________________________________________________________________________________________________________________116____ 
 1kcr(H) : QVALQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYIRNGGSTTYNPSLASRISITRDTSKNQFFLQLNSVTTEDTATYYCARGGTGFTYWGAGTLVTVSAAATT 
         :                                                                                                                          
 1kcu(H) : QVKLQQSGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMAYISYSGSTTYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTAIYYCARGGTGFDYWGAGTTLTVSAAATT 
           _________________________________________________________________________________________________________________116____ 

           __________________________________________________________________________________________________                       
 1kcr(H) : PPSVYPLAPGSAAAAAAMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSALYTLSSSVTVPSSPRPSATVTCNVAHPASSTKVDKKIVPRDC                       
         :                                                                                                                          
 1kcu(H) : PPSVYPLAPGSATAAASMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSDLYTLSSSVTVPSSPWPSETVTCNVAHPASSTKVDKKIVPRD*                       
           __________________________________________________________________________________________________                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		33.5
Translation
(A) 		-1.6
Closure
(%) 		97.2
Bending Residues
( green ) 		  116 - 117
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download