Penicillin-Binding Protein-Related Factor A

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Penicillin-Binding Protein-Related Factor A
  Conformer 1
(PDB) 		1y1o (A)
  Conformer 2
(PDB) 		1y1o (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 140 0.53   34 - 57   80 - 196
2 22 0.88   58 - 79

Sequence


           _______________________56_____________________79________________________________________________________________________ 
 1y1o(A) : TLEDDLNATNEYYRERGIAVIHKKPTPVQIVRVDYPKRSAAVITEAYFRQASTTDYNGVYRGKYIDFEAKETKNKTAFPLKNFHAHQIRHeQVVAHGGICFAILRFSLLNETYLLDASHL 
         :                                                                                                                          
 1y1o(D) : TLEDDLNATNEYYRERGIAVIHKKPTPVQIVRVDYPKRSAAVITEAYFRQASTTDYNGVYRGKYIDFEAKETKNKTAFPLKNFHAHQIRHeQVVAHGGICFAILRFSLLNETYLLDASHL 
           _______________________56_____________________79________________________________________________________________________ 

           ______________________________________________                                                                           
 1y1o(A) : IAWWNKQEAGGRKSIPKQEIERHGHSIPLGYQPRLDYISVVDNVYF                                                                           
         :                                                                                                                          
 1y1o(D) : IAWWNKQEAGGRKSIPKQEIERHGHSIPLGYQPRLDYISVVDNVYF                                                                           
           ______________________________________________                                                                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		27.8
Translation
(A) 		0.0
Closure
(%) 		99.9
Bending Residues
( green ) 		  56 - 59
  79 - 84
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download